S1C2A_RAT Q9WUW9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WUW9
Recommended name：Sulfotransferase 1C2A
EC number：EC:2.8.2.1
Alternative names：ST1C2A; rSULT1C2A 1 Publication
Cleaved into：
GeneID：316153
Gene names (primary )：Sult1c2a
Gene names (synonym )：Sultk2
Gene names (ORF )：
Length：296
Mass：34,859
Sequence：MALAPELSRQTKLKEVAGIPLMDPTVNNWSQIQTFKAKPDDLLICTYPKSGTTWIQEIVNMIEQNGDVEKCQRTIIQHRHPVIEWARPPQPSGVDKANAMPAPRILRTHLPPQLLPPSFWTNNCKYLYVARNAKDCMVSYYHFYRMCQVLPNPGTWNEYFETFINGKVSWGSWFDHVKGWWEIRDRYQILFLFYEDMKRDPKREIQKVMQFMGKNLDEEVVDKIVLETSFEKMKDNPLTNFSTIPKTIMDQSISPFMRKGIVGDWKNHFTVAQNERFDEIYEQKMDGTSLNFCMEL
Tissue specificity：Highly expressed in kidney and at lower levels in stomach and liver. More specifically found in the epithelia of proximal tubules of the kidney, of the bile duct, of the gastric mucosa, and in hepatocytes. 1
Induction：
Developmental stage：
Protein families：