IP6K2_RAT   Q9R0U1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9R0U1

Recommended name:Inositol hexakisphosphate kinase 2

EC number:EC:2.7.4.-

Alternative names:InsP6 kinase 2

Cleaved into:

GeneID:59268

Gene names  (primary ):Ip6k2

Gene names  (synonym ):Ihpk2, Pius

Gene names  (ORF ):

Length:425

Mass:49,164

Sequence:MSPAFRTMDVEPRTKGILLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRRFTPQYKGVVSVRFEEDEDRNLCLIAYPLKGDHGPVDIVDNSDCEPKSKLLRWTNKKHHVLETEKSPKDWVRQHRKEEKMKSHKLEEEFEWLKKSEVLYYSVEKKGTVSSQLKHYNPWSMKCHQQQLQRMKENAKHRNQYKFILLENLTCRYEVPCVLDLKMGTRQHGDDASEEKAANQIRKCQQSTSAVIGVRVCGMQVYQAGTGQLMFMNKYHGRKLSVQGFKEALFQFFHNGRYLRRELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGKEWPEVTLDSDAEDLEDLSEESADESAGAYAYKPLGASSVDVRMIDFAHTTCRLYGEDSVVHEGQDAGYIFGLQSLIDIVTEISEESGE

Tissue specificity:Highly expressed in small intestine. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp