MUC24_RAT   Q9QX82


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QX82

Recommended name:Sialomucin core protein 24

EC number:

Alternative names:Endolyn Multi-glycosylated core protein 24 (MGC-24; MGC-24v)

Cleaved into:

GeneID:83689

Gene names  (primary ):Cd164

Gene names  (synonym ):

Gene names  (ORF ):

Length:195

Mass:20,476

Sequence:MSGASRGLFWAATCLAALCLSAAQSNSSASPNVTDPPTTTSKVVPTTLTTTKPPETCESFNSCVSCVNATLTNNITCVWLDCHEANKTYCSSELVSNCTQKTSTDSCSVIPTTPVPTNSTAKPTTRPSSPTPTPSVVTSAGATNTTVTPTSQPERKSTFDAASFIGGIVLVLGVQAVIFFLYKFCKSKERNYHTL

Tissue specificity:Ubiquitous. Expressed at highest levels in the liver, kidney, lung and intestine. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp