FXYD6_RAT   Q91XV6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91XV6

Recommended name:FXYD domain-containing ion transport regulator 6

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):Fxyd6

Gene names  (synonym ):Php

Gene names  (ORF ):

Length:94

Mass:10,388

Sequence:METVLILCSLLAPVVLASAAEKEKEKDPFYYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPRAPGDEEAQVENLITTNAAEPQKAEN

Tissue specificity:Expressed in the neuronal fibers of the medial part of lateral habenula nucleus, thalamus, hypothalamus, stria terminalis, zona incerta, amygdaloid body and cingulum, olfactory bulb, hippocampus, cerebral cortex and cerebellum. In the cerebellum there is a predominant expression pattern in the granule layer of lobules VI-IX of the posterior lobe (PubMed:11165386). Detected in inner ear (PubMed:17209044). 2 s

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp