MSTN1_RAT Q80XX4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80XX4
Recommended name:Musculoskeletal embryonic nuclear protein 1
EC number:
Alternative names:
Cleaved into:
GeneID:290553
Gene names (primary ):Mustn1
Gene names (synonym ):
Gene names (ORF ):
Length:82
Mass:8,985
Sequence:MSEAGTPEAPIKKKRPPVKEEDLKGARGSLSKNQEIKSKTYQVMRDYEQAGSAAPSIFSRNRTGTETVFEKPKEGPAKSVFG
Tissue specificity:Expressed specifically in the musculoskeletal system (skeletal muscle and tendon). Highly expressed during bone regeneration, especially during the early phases (post fracure days 3 and 5). Expression within the fracture callus is localized in osteoprogenitor cells of the periosteum, proliferating chondrocytes, and young active osteoblasts. 1
Induction:
Developmental stage:Abundantly expressed in developing embryos, especially in mesenchymal condensations of limbs, vertebral perichondrium and mesenchymal cells of the intervertebral disks. 1
Protein families: