UBE2F_RAT Q5U203
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5U203
Recommended name：NEDD8-conjugating enzyme UBE2F
EC number：EC:2.3.2.34
Alternative names：NEDD8 carrier protein UBE2F NEDD8 protein ligase UBE2F RING-type E3 NEDD8 transferase UBE2F Ubiquitin-conjugating enzyme E2 F
Cleaved into：
GeneID：
Gene names (primary )：Ube2f
Gene names (synonym )：
Gene names (ORF )：
Length：185
Mass：21,080
Sequence：MLTLASKLKRDDGLKGSRASASTSDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVSPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRDKVDEYIKRYAR
Tissue specificity：
Induction：
Developmental stage：
Protein families：