RN135_RAT   Q5M929


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5M929

Recommended name:E3 ubiquitin-protein ligase RNF135 Curated

EC number:EC:2.3.2.27

Alternative names:RING finger protein 135 RING-type E3 ubiquitin transferase RNF135 Curated

Cleaved into:

GeneID:303350

Gene names  (primary ):Rnf135

Gene names  (synonym ):

Gene names  (ORF ):

Length:415

Mass:46,012

Sequence:MAAACPGTAVPVWLSEEDLSCIICQGLLDWPTTLPCGHSFCLQCLKDLWVSKRAGVDSCPWACPICRKGPSAKPVLHKNPLLQDLVDKYRQAALELEAGPEPAPVPRSLCTPTPPQVTVQKSTTQVVQELTELVGQLVDIVKSLQTQRPSLASGLDNALGILHMDSSSEEEYPLDSPKLVTFSASQKKIQEILRDLEKIQETLQGSVTGNEAPKKQVEEMASSVGLLPDQRYPVSRKASQFSLWAISPTFDLRSLSCNLEVSNNCRMVTVSRALQPYHWSSERFSISQVLCSQAFSSGQKYWEVDTRNCSHWAVGVASWGMKRDKMLGRTMDSWCIEWRGPSQFSAWAMMKKTDLSSGPPEVVGVWLDLELGKLAFYSVADQERPLYECEVSSSSPLHPAFWLYGLTPGNYLEIL

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp