TRI69_RAT   Q5BK82


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5BK82

Recommended name:E3 ubiquitin-protein ligase TRIM69

EC number:EC:2.3.2.27

Alternative names:RING finger protein 36 RING-type E3 ubiquitin transferase TRIM69 Curated Tripartite motif-containing protein 69

Cleaved into:

GeneID:311373

Gene names  (primary ):Trim69

Gene names  (synonym ):Rnf36

Gene names  (ORF ):

Length:499

Mass:57,215

Sequence:MEVSSRPPSNFDPGNYVEVSDPSTHLPSKVVIQDITTELHCPLCNDWFRDPLMLTCGHNFCQACIQNYWKMQAKETFCPECKMLCQYSNCTFNLVLEKLVEKIKRLPLLKGHPQCPEHGENLKLFSKPDGKMICFQCKDARLSMGQSKDFLQISEAVRFFTEELAIYQSQLQTTLKELQSLRTMQKDAIAAYKDNKIQLQQNLSLEFLKLHQFLHNKEKDILNDLRDEGKVLNEEMDANLNQIQEQCLLAKDMLANIQARMEQQNSFDFLTDITKLLENMEKGMKTLVPRQLISKKLSLGRFKGPIQYTIWREMQSILSPGPSQLTLDPKTAHPNLVLSNSRTSVCHGDVKQVMPDDPERFDSSVAVLGSKGFTSGKWYWEIEVAKKTKWTIGIVRESIIRKGSCPLTPEQGFWLLRLRNQTDLKALDLPSCSLNLGDLRRVGVYLDYEGGQVSFYNATNMTHLYTFTSVFLEKLFPYLCPCLNDGGENKEPLHIVHPQ

Tissue specificity:

Induction:

Developmental stage:

Protein families:TRIM/RBCC family


   💬 WhatsApp