UB2L6_RAT   Q4V8J2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q4V8J2

Recommended name:Ubiquitin/ISG15-conjugating enzyme E2 L6

EC number:EC:2.3.2.23

Alternative names:E2 ubiquitin-conjugating enzyme L6 Ubiquitin carrier protein L6 Ubiquitin-protein ligase L6

Cleaved into:

GeneID:295704

Gene names  (primary ):Ube2l6

Gene names  (synonym ):

Gene names  (ORF ):

Length:153

Mass:17,807

Sequence:MTASKRVAKELDDLSKELPPYLRHLSSDDANVLVWHMLLLPDQLPYRLKAFGLRIDFPREYPLKPPTLRFTTKIYHPNISEDGLVCLPLISTENWKPYTKAYQVLEALNILVSRPNLEEPVRLELADLLTQDPEMFRKKAEEFTLQYGVDRPS

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp