SELW_RAT P63301
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P63301
Recommended name：Selenoprotein W 1 Publication
EC number：
Alternative names：
Cleaved into：
GeneID：25545
Gene names (primary )：Selenow
Gene names (synonym )：Selw 1 Publication, Sepw1 Imported
Gene names (ORF )：
Length：88
Mass：9,687
Sequence：MALAVRVVYCGAUGYKPKYLQLKEKLEHEFPGCLDICGEGTPQVTGFFEVTVAGKLVHSKKRGDGYVDTESKFRKLVTAIKAALAQCQ
Tissue specificity：Higher levels are seen in the muscle and brain while lower levels are seen in the spleen and testis. Not detected in liver, heart, kidney, intestinal mucosa, intestinal muscle, lung, plasma or erythrocytes (at protein level). 1
Induction：
Developmental stage：In skeletal muscle, by dietary selenium. 1
Protein families：