ST1C1_RAT P50237
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P50237
Recommended name：Sulfotransferase 1C1
EC number：EC:2.8.2.-
Alternative names：ST1C1
Cleaved into：
GeneID：65185
Gene names (primary )：Sult1c1
Gene names (synonym )：St1c1
Gene names (ORF )：
Length：304
Mass：35,764
Sequence：MSLEKMKDLHLGEQDLQPETREVNGILMSKLMSDNWDKIWNFQAKPDDLLIATYAKAGTTWTQEIVDMIQNDGDVQKCQRANTYDRHPFIEWTLPSPLNSGLDLANKMPSPRTLKTHLPVHMLPPSFWKENSKIIYVARNAKDCLVSYYYFSRMNKMLPDPGTLGEYIEQFKAGKVLWGSWYDHVKGWWDVKDQHRILYLFYEDMKEDPKREIKKIAKFLEKDISEEVLNKIIYHTSFDVMKENPMANYTTLPSSIMDHSISPFMRKGMPGDWKNYFTVAQSEDFDEDYRRKMAGSNITFRTEI
Tissue specificity：Liver. Male >> Female. 1
Induction：Male specific. Maximum at 9 weeks and maintained in 9-month-old rats. Can be detected at low level in females up to 9-weeK-old rats but then decreases to undetectable level. 1 Publication
Developmental stage：Induced by estrogens and suppressed by androgens. 1
Protein families：