QCR2_RAT   P32551


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P32551

Recommended name:Cytochrome b-c1 complex subunit 2, mitochondrial

EC number:

Alternative names:

Cleaved into:

GeneID:293448

Gene names  (primary ):Uqcrc2

Gene names  (synonym ):

Gene names  (ORF ):

Length:452

Mass:48,396

Sequence:MKLLSRAGSFSRFYSLKVAPKLKTSAPGGVPLQPQELEFTKLPNGLVIASLENYAPLSRIGLFIKAGSRYENYNYLGTSHLLRLASTLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVEGIRDDIEILMEFLLNVTTAPEFRRWEVAALRSQLKIDKAVAFQNPQTRIIENLHDVAYKNALANPLYCPDYRMGKITSEELHYFVQNHFTSARMALVGLGVSHSILKEVAEQFLNIRGGLGLAGAKAKYRGGEIREQNGDNLVHAAIVAESAAIGNAEANAFSVLQHLLGAGPHIKRGNNTTSLLSQSVAKGSQQPFDVSAFNASYSDSGLFGIYTVSQAAAAGDVINAAYNQVKAVAQGNLSSADVQAAKNKLKAGYLMSVETSEGFLSEIGSQALATGSYMPPPTVLQQIDAVADADVVKAAKKFVSGKKSMTASGNLGHTPFLDEL

Tissue specificity:Expressed in the head region and flagellum of epididymal sperm. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp