CYC2_RAT P10715
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P10715
Recommended name：Cytochrome c, testis-specific
EC number：
Alternative names：
Cleaved into：
GeneID：25310
Gene names (primary )：Cyct
Gene names (synonym )：
Gene names (ORF )：
Length：105
Mass：11,743
Sequence：MGDAEAGKKIFIQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTDANKNKGVIWTEETLMEYLENPKKYIPGTKMIFAGIKKKSEREDLIQYLKEATSS
Tissue specificity：This is one of two isocytochromes C found in the testis. The other is identical with the form found in other rat tissues. These cytochromes are assumed to be located in the sperm.
Induction：
Developmental stage：
Protein families：