LANC1_RAT Q9QX69
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QX69
Recommended name：Glutathione S-transferase LANCL1 By Similarity
EC number：EC:2.5.1.18
Alternative names：40 kDa erythrocyte membrane protein (p40 1 Publication) LanC-like protein 1 By Similarity
Cleaved into：
GeneID：114515
Gene names (primary )：Lancl1
Gene names (synonym )：Gpr69a 1 Publication
Gene names (ORF )：
Length：399
Mass：45,240
Sequence：MAQRAFPNPYADYNKSLAENYFDSTGRLTPEFSHRLTNKIRELLQQMERGLKSADPQDGTGYTGWAGIAVLYLHLHNVFGDPAYLQMAHSYVKHSLNCLSRRSITFLCGDAGPLAVAAVLYHKMNSGKQAEDCITRLIHLNKIDPHVPNEMLYGRIGYIFALLFVNKNFGEEKIPQSHIQQICETILTSGEKLSRKRNFTTKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLHVSQGKLHSLVKPSVDFVCQLKFPSGNYPSCLDDTRDLLVHWCHGAPGVIYMLIQAYKVFKEEHYLCDAQQCADVIWQYGLLKKGYGLCHGAAGNAYAFLALYNLTQDAKYLYRACKFAEWCLDYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKAKFPAFEL
Tissue specificity：Strongly expressed in the brain, testis and skeletal muscle. Expressed in the neurons of the cerebellum, the germinal cells of the seminiferous tubules in testis, in liver hepoatocytes and in cardiac myocytes. 1
Induction：
Developmental stage：
Protein families：