HINT3_RAT   Q8K3P7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8K3P7

Recommended name:Adenosine 5'-monophosphoramidase HINT3 By Similarity

EC number:EC:3.9.1.-

Alternative names:HINT-4 Histidine triad nucleotide-binding protein 3 (HINT-3)

Cleaved into:

GeneID:

Gene names  (primary ):Hint3

Gene names  (synonym ):Hint4

Gene names  (ORF ):

Length:175

Mass:19,694

Sequence:MAEKQAGLAGEPNPDCTVTAKAGPEVSSPGTSESRDYDSNCVFCRVAAGQEPETELLYCENKDLVCFKDIKPAALHHYLVVPKKHIGSCKDLNKDHIEMVESMVTVGKTILERNNFTDFTDVRMGFHVPPFCSVSHLHLHVIAPAKEFGFLSRVVYRRDSYWFITGDYLLEKLRK

Tissue specificity:Expressed in retinal ganglion cells. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp