K1C9_RAT Q8CIS9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8CIS9
Recommended name：Keratin, type I cytoskeletal 9
EC number：
Alternative names：
Cleaved into：
GeneID：266717
Gene names (primary )：Krt9
Gene names (synonym )：Krt1-9 Imported
Gene names (ORF )：
Length：618
Mass：63,009
Sequence：MSFRQISSSFRSSSGSSCGGGGGRGASRGSMRSSFGRSSRAGGESRFGSSSGFGGGGFSACGTGGGGSFGSSYGGGYGRGFSAGSSSGMFGGSSRGCFGGGSGGGFGGGSGGGFGGGFGGGFGGGSGGGEGSILNTNEKVVMQNLNSRLASYMDKVQELEEDNANLEKQIQEWYSRKGNRVFQKDYSHYYNTIEDLKDRIVDLTARNNKALIDMDNTRMTLGDFRVKLEMEQSLPQGVDADINGLQKVLDDINMEKSDLEIQFDSLDDELKALKKSHKEEMNQLTGLNDGDVNVEINVAPSTDLTQVLNDMREEYEHLISKNRQDIEQHYESQMTQIEHQLTNSGPEMETNMKQVSQLQHSVQELNIELQTQLTTKSALEKALEDTKNRYCGQLQQIREQISEMEAQLAQVRAETECQNQEYGLLLSIKTRLEKEIETYRKLLEGGQQDFESSGAGQIGFGSGKGGQRGSGGSYGGGSGDSYEGESGGSYGGGSGGSHGGKSGGSYGGGSSSGGGSGGSYGGGSGGSHGGKSGGSHGGGSGGSYGGGSGSGGESGGSYGGGSGGSHGGQKGGSGGSYEGGSGGSYGGGSGSGGGSGGSYGGGNTRPSQSQSSQIPRLR
Tissue specificity：Expressed in the perinuclear ring of spermatid manchettes within testis and in keratinocytes of the suprabasal layer of footpad epidermis (at protein level). 1
Induction：
Developmental stage：
Protein families：