DHSD_RAT Q6PCT8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6PCT8
Recommended name：Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
EC number：
Alternative names：CII-4 Malate dehydrogenase [quinone] cytochrome b small subunit QPs3 Succinate dehydrogenase complex subunit D Succinate-ubiquinone oxidoreductase cytochrome b small subunit Succinate-ubiquinone reductase membrane anchor subunit
Cleaved into：
GeneID：363061
Gene names (primary )：Sdhd
Gene names (synonym )：
Gene names (ORF )：
Length：159
Mass：16,976
Sequence：MAVLLKLGVLCSGQGARALSLRSRAVRPAFVSAFLQDQPTPGWRGTQHIHLSPSHQSGSKAASLHWTSERVVSVLLLGLIPAGYLNPCSVVDYSLAAALTLHSHWGIGQVVTDYVHGDALQKATKAGLLAVSALTFAGLCYFNYHDVGICRAVAMLWKL
Tissue specificity：
Induction：
Developmental stage：
Protein families：