ARTN_RAT Q6AYE8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6AYE8
Recommended name：Artemin
EC number：
Alternative names：
Cleaved into：
GeneID：362572
Gene names (primary )：Artn
Gene names (synonym )：
Gene names (ORF )：
Length：224
Mass：23,656
Sequence：MELGLGEPTALSHCLRPRWQPALWPTLAALALLSSVTEASLDPMSRSPASRDVPSPVLAPPTDYLPGGHTAHLCSERALRPPPQSPQPAPPPPGPALQSPPAALRGARAARAGTRSSRARATDARGCRLRSQLVPVSALGLGHSSDELIRFRFCSGSCRRARSPHDLSLASLLDAGALRSPPGSRPISQPCCRPTRYEAVSFMDVNSTWRTVDHLSATACGCLG
Tissue specificity：Cochlea. Expressed at higher level in sesorineural epithelium than in the modiolus region or substantia nigra. 2 s
Induction：
Developmental stage：Expressed during embryogenesis. At 14 dpc, not detected in the brain or spinal cord. A striking expression seen in the nerve roots but not in the developing neurons of the dorsal root ganglia. A significant expression also seen around the superior mesentric artery. 1
Protein families：