KRBBB_RAT   Q5NKN4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5NKN4

Recommended name:Killer cell lectin-like receptor subfamily B member 1B allele B

EC number:

Alternative names:CD161b

Cleaved into:

GeneID:

Gene names  (primary ):Klrb1b

Gene names  (synonym ):Nkrp1b, Nkrp1c

Gene names  (ORF ):

Length:223

Mass:24,884

Sequence:MDTAVVYADLHLARTGEPKHKSPPSLSPDTCQCPRWHRLALKLGCACLILLVLSVIGLGVLVLTLLQKPLIQNSPADVQENRTKTTDSPTKLKCPKDWHSHQDKCFHVSQAPNTWNKSLADCGGKGATLLLIQDQEELRFLRNLTKGKDRSFWIGLNYTLPDKNWKWINSSTLNSDVLSIFGDTKQNSCASISQDKVLSESCDSDNLWICQKELKCECMCNGS

Tissue specificity:Expressed in a subset of natural killer cells. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp