TMCO1_RAT   Q5I0H4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5I0H4

Recommended name:Calcium load-activated calcium channel By Similarity

EC number:

Alternative names:GEL complex subunit TMCO1 Curated Meg-2-like protein 1 Publication Transmembrane and coiled-coil domain-containing protein 1 Curated

Cleaved into:

GeneID:289196

Gene names  (primary ):Tmco1

Gene names  (synonym ):

Gene names  (ORF ):

Length:188

Mass:21,175

Sequence:MSTMFADTLLIVFISVCTALLAEGITWVLVYRTDKYKRLKAEVEKQSKKLEKKKETITESAGRQQKKKIERQEEKLKNNNRDLSMVRMKSMFAIGFCFTALMGMFNSIFDGRVVAKLPFTPLSYIQGLSHRNLLGDDTTDCSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp