AR2BP_RAT   Q4V8C5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q4V8C5

Recommended name:ADP-ribosylation factor-like protein 2-binding protein

EC number:

Alternative names:Binder of ARF2 protein 1

Cleaved into:

GeneID:

Gene names  (primary ):Arl2bp

Gene names  (synonym ):Bart, Bart1

Gene names  (ORF ):

Length:163

Mass:18,683

Sequence:MDALEEESFALSFSSASDAEFDAVVGCLEDIIMDAEFQLLQRSFMDKYYQEFEDTEENKLTYTPIFNEYISLVEKYIEEQLLERIPGFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSTPASQNNLRH

Tissue specificity:Ubiquitous with higher expression in brain, especially in hippocampus and cortex. Also expressed in lung, cerebellum, liver, kidney, spleen and heart (at protein level). 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp