GRZ2_RAT Q06606
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q06606
Recommended name：Granzyme-like protein 2 Curated
EC number：EC:3.4.21.-
Alternative names：GLP-2 Granzyme-like protein II (GLP II) Mast cell protease 10 (rMCP-10) Mast cell protease X (rMCP-X)
Cleaved into：
GeneID：54269
Gene names (primary )：Mcpt10
Gene names (synonym )：
Gene names (ORF )：
Length：248
Mass：27,486
Sequence：MFLFLIFLVAVLPVNTEGGEIVWGTESKPHSRPYMASLMFYYGNSYRHYCGGFLVAKDIVMTAAHCNESNIKVILGAHNIKKRENTQVFSVVKAKPHENYDSHSLFNDIMLLKLERKAQLNGVVKTIALPRSQDWVKPGQVCTVAGWGRLANCTLSNTLQEVNLEVQKGQKCQGMSEDYNDSIQLCVGNPSEGKATGKGDSGGPFVCDGVAQGIVSRRLCTGTLPRVFTRISTFIPWIQKTMKLLQQP
Tissue specificity：Duodenum, lung and spleen.
Induction：
Developmental stage：
Protein families：