CAH5A_RAT P43165
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P43165
Recommended name：Carbonic anhydrase 5A, mitochondrial 1 Publication
EC number：EC:4.2.1.1
Alternative names：Carbonate dehydratase VA Carbonic anhydrase VA (CA-VA)
Cleaved into：
GeneID：54233
Gene names (primary )：Ca5a
Gene names (synonym )：Ca5
Gene names (ORF )：
Length：304
Mass：34,499
Sequence：MLRAKMLGRGPYKPLAILRHMGPLCATRPQHWRFQHSYAEKHSNCARHPLWTGPVSSPGGTQQSPINIQWTDSVYDPKLAPLRVSYDAASCRYLWNTGYFFQVEFDDSCEESGISGGPLGNHYRLKQFHFHWGATDEWGSEHMVDGHAYPAELHLVHWNSMKYENYKKATTGENGLAVIGVFLKLGAHHEALQRLVDILPEVRHKDTQVTMGPFDPSCLLPACRDYWTYPGSLTTPPLAESVTWIVHKMPIEVSPSQLSTFRTLLFSGRGEDEEVMVNNFRPLQPLRGRNVRSSFQVPRVGTKS
Tissue specificity：High in liver, also detected in heart, lung, kidney, spleen and intestine. 1
Induction：
Developmental stage：
Protein families：