CP2G1_RAT P10610
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P10610
Recommended name：Cytochrome P450 2G1
EC number：EC:1.14.14.1
Alternative names：CYPIIG1 Cytochrome P450 olfactive Cytochrome P450-OLF1
Cleaved into：
GeneID：25251
Gene names (primary )：Cyp2g1
Gene names (synonym )：Cyp2g-1
Gene names (ORF )：
Length：494
Mass：56,781
Sequence：MALGGAFSIFMTLCLSCLLILIAWKRTSRGGKLPPGPTPIPFLGNLLQVRIDATFQSFLKLQKKYGSVFTVYFGPRPVVILCGHEAVKEALVDQADDFSGRGEMPTLEKNFQGYGLALSNGERWKILRRFSLTVLRNFGMGKRSIEERIQEEAGYLLEELHKVKGAPIDPTFYLSRTVSNVICSVVFGKRFDYEDQRFRSLMKMINESFVEMSMPWAQLYDMYWGVIQYFPGRHNRLYNLIEELKDFIASRVKINEASFDPSNPRDFIDCFLIKMYQDKSDPHSEFNLKNLVLTTLNLFFAGTETVSSTLRYGFLLLMKYPEVEAKIHEEINQVIGTHRTPRVDDRAKMPYTDAVIHEIQRLTDIVPLGVPHNVIRDTHFRGYFLPKGTDVYPLIGSVLKDPKYFRYPEAFYPQHFLDEQGRFKKNDAFVAFSSGKRICVGEALARMELFLYFTSILQRFSLRSLVPPADIDIAHKISGFGNIPPTYELCFMAR
Tissue specificity：Olfactory epithelium.
Induction：
Developmental stage：
Protein families：