PR3B1_RAT P09321
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P09321
Recommended name：Prolactin-3B1
EC number：
Alternative names：
Cleaved into：
GeneID：24283
Gene names (primary )：Prl3b1
Gene names (synonym )：Csh2, Pl2
Gene names (ORF )：
Length：221
Mass：25,007
Sequence：MQLSLTQPCFSGTLLMLAVSTLLLWEQVTSAPNYRMSTGSLYQRVVELSHYTHDLASKVFIEFDMKFGRTVWTHNLMLSPCHTAAIPTPENSEQVHQAKSEDLLKVSITILQAWQEPLKHIVAAVATLPDGSDTLLSRTKELEERIQGLLEGLETILSRVQPGAVGSDYTFWSEWSDLQSSDKSTKNGVLSVLYRCMRRDTHKVDNFLKVLKCRDIYNNNC
Tissue specificity：Placental lactogen II is expressed from days 12 to term of pregnancy.
Induction：
Developmental stage：
Protein families：