THRSP_RAT P04143
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P04143
Recommended name:Thyroid hormone-inducible hepatic protein
EC number:
Alternative names:
Cleaved into:
GeneID:
Gene names (primary ):Thrsp
Gene names (synonym ):S14
Gene names (ORF ):
Length:150
Mass:17,009
Sequence:MQVLTKRYPKNCLLKVMDRYSAVVRNMEQVVMIPSLLRDVELSGSGGSVQDGAPDLYTYFTMLKSICVEVDHGLLPREEWQAKVAGNEGSEAENEAAETEEAEEDRLSEELDLEAQFHLHFSSLHHILTHLTQKAQEVTQKYQEMTGQVL
Tissue specificity:Highly expressed in liver, lactating mammary gland, epididymal, retroperitoneal and brown fat. Mainly expressed in tissues that synthesize triglycerides. 1
Induction:
Developmental stage:The mRNA levels in rat liver are up-regulated in response to thyroid hormone (T3) and a carbohydrate-rich diet. Up-regulated in liver at the time of weaning, when pups switch from a high-fat milk diet to having to synthesize their own fatty acids. Down-regulated by fasting. Levels of mRNA increase within 20 minutes of T3 administration. 3 s
Protein families: