UNC50_RAT O55227
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O55227
Recommended name：Protein unc-50 homolog
EC number：
Alternative names：
Cleaved into：
GeneID：192356
Gene names (primary )：Unc50
Gene names (synonym )：Uncl
Gene names (ORF )：
Length：259
Mass：30,436
Sequence：MLPSTSLNSSMYGNGALNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLLISTLMWFISNKYLVKRQSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVVLLYPFAPLIVLYGLSLALGWNFTHTLCSFYKYRVK
Tissue specificity：Expressed in brain, kidney and testis, and at lower levels in heart. 1
Induction：Not present in the maxillary first molar tooth before 18 dpc. Present at high levels in ameloblasts and adjacent cells at P7. At P14, present in differentiating pre-cementoblasts and pre-osteoblasts along the developing root surface and alveolar bone. At P28, present in cementoblastic cells in the periodontal ligament and osteoblastic cells on the alveolar bone surface (at protein level). 1 Publication
Developmental stage：By mechanical tensile force in periodontal ligament fibroblasts. 1
Protein families：