TAFA5_RAT M0R7X9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:M0R7X9
Recommended name:Chemokine-like protein TAFA-5
EC number:
Alternative names:
Cleaved into:
GeneID:500915
Gene names (primary ):Tafa5
Gene names (synonym ):Fam19a5 Imported
Gene names (ORF ):
Length:132
Mass:14,331
Sequence:MAPSPRTSSRQDATALPSMSSTFWAFMILASLLIAYCSQLAAGTCEIVTLDRDSSQPRRTIARQTARCACRKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCTQPGGRIKTTTVS
Tissue specificity:Expressed in the epididymal adipose tissue, in aortic adventitial fibroblasts and low expression in vascular smooth muscle cells (at protein level) (PubMed:29453251). Expressed in the central nervous system, highly expressed in the hypothalamic paraventricular nucleus (PubMed:29453251). 1
Induction:
Developmental stage:Repressed in adipocytes after stimulation with Tnfa, Il6 and Ins1 (PubMed:29453251). Specifically down-regulated in the hypothalamic paraventricular nucleus following water deprivation (PubMed:29453251). 1
Protein families: