TAAR1_RAT Q923Y9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q923Y9
Recommended name：Trace amine-associated receptor 1
EC number：
Alternative names：
Cleaved into：
GeneID：113914
Gene names (primary )：Taar1 1 Publication
Gene names (synonym )：Ta1 1 Publication, Tar1 1 Publication, Trar1
Gene names (ORF )：
Length：
Mass：38,021
Sequence：MHLCHNSANISHTNSNWSRDVRASLYSLISLIILTTLVGNLIVIISISHFKQLHTPTNWLLHSMAVVDFLLGCLVMPYSMVRTVEHCWYFGELFCKLHTSTDIMLSSASILHLAFISIDRYYAVCDPLRYKAKINLAAIFVMILISWSLPAVFAFGMIFLELNLEGVEELYHNQVFCLRGCFPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIYFIAKGQARSINRANLQVGLEGESRAPQSKETKAAKTLGIMVGVFLLCWCPFFFCMVLDPFLGYVIPPTLNDTLNWFGYLNSAFNPMVYAFFYPWFRRALKMVLFGKIFQKDSSRSKLFL
Tissue specificity：Widely distributed, but in low abundance, throughout the brain (PubMed:11459929). Highest levels detected in the olfactory bulb, nucleus accumbens/olfactory tubercle, prefrontal cortex and other cortical regions, midbrain regions consisting of substantia nigra and ventral tegmentum, cerebellum, and pons/medulla (PubMed:11459929). Among peripheral tissues, highest level observed in the liver, less expression in kidney, gastrointestinal tract, spleen, pancreas, and heart (PubMed:11459929). 1
Induction：
Developmental stage：
Protein families：