MSI1H_RAT Q8K3P4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8K3P4
Recommended name：RNA-binding protein Musashi homolog 1
EC number：
Alternative names：
Cleaved into：
GeneID：259272
Gene names (primary )：Msi1
Gene names (synonym )：Msi1h
Gene names (ORF )：
Length：362
Mass：39,134
Sequence：METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVRGTGSHPWTMAPPPGSTPSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGGPLIATAFTNGYH
Tissue specificity：Expressed in stem and progenitor cells in the subventricular zone of the hippocampus (at protein level) (PubMed:16554442). Detected throughout the hippocampus (PubMed:12205668). Detected in astrocytes, ependymal cells and in the anterior subventricular zone. Detected in proliferating cells (PubMed:12205668). 2 s
Induction：
Developmental stage：Up-regulated in the CA1 region of the hippocampus after ischemia. 1
Protein families：Musashi family