HS3S2_RAT   Q80W66


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q80W66

Recommended name:Heparan sulfate glucosamine 3-O-sulfotransferase 2

EC number:EC:2.8.2.29

Alternative names:Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 2 (Heparan sulfate 3-O-sulfotransferase 2)

Cleaved into:

GeneID:293451

Gene names  (primary ):Hs3st2

Gene names  (synonym ):3ost2

Gene names  (ORF ):

Length:367

Mass:41,378

Sequence:MAYRVLGRAGPPQPRRARRLLFAFTLSLSCTYLCYSFLCCCDGLGQSRLLGAPRCLRGPSASGQKLLAKSRPCDPPGPTPSEPSAPSAPAAAAPAPRLSGSNHSGSPKPGTKRLPQALIVGVKKGGTRAVLEFIRVHPDVRALGTEPHFFDRNYGRGLDWYRSLMPRTLETQITLEKTPSYFVTQEAPRRIFNMSRDTKLIVVVRNPVTRAISDYTQTLSKKPDIPTFEGLSFRNRSLGLVDVSWNAIRIGMYALHLESWLRYFPLAQIHFVSGERLITDPAGEMGRIQDFLGIKRFITDKHFYFNKTKGFPCLKKPESTLLPRCLGKSKGRTHVQIDPEVIDQLREFYRPYNIKFYETVGQDFRWE

Tissue specificity:Highly expressed in the brain, in the pineal gland specifically during the daylight hours, and weakly in the olfactory bulb and pineal gland during the night. First detected between postnatal days 5 and 10. 1

Induction:

Developmental stage:Activated by light stimulation at night through the suppression of beta-adrenergic signaling. 1

Protein families:


   💬 WhatsApp