SIAT9_RAT   Q68G12


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q68G12

Recommended name:Lactosylceramide alpha-2,3-sialyltransferase

EC number:EC:2.4.3.9

Alternative names:CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase Ganglioside GM3 synthase ST3Gal V (ST3GalV) Sialyltransferase 9

Cleaved into:

GeneID:83505

Gene names  (primary ):St3gal5

Gene names  (synonym ):Siat9

Gene names  (ORF ):

Length:387

Mass:44,640

Sequence:MPNEFTSAKLRSDCSRTSLQWYTQTQHKMRRPSLLLKDILKCMLVVFGVWLLYILKLNYTAEECDMKKLNYVDPARIKRAHRNTQEVFQKECRPGHAKKTMDLLFKGKYSMDLEPFVQKIPTASEAELKYDPPFGFRKFSSKVQSLLDMLPEHDFPEHLRAKHCKRCVVIGNGGILHGLELGHALNQFDVVIRLNSAPIEGYSEHVGNKTTIRMTYPEGAPLSDAEYYANDLFVAVLFKSVDFKWLQAMVKNESLPFWIRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGHDKNIPTIGIIAIVLATHLCDEVSLAGFGYDLSQPRTPLHYFDSQCMGAMNWQVMHNVTTETQFLQKLIKEGVVQDLSGGIH

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp