NPY4R_RAT Q63447
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63447
Recommended name：Neuropeptide Y receptor type 4
EC number：
Alternative names：Pancreatic polypeptide receptor 1 (PP1)
Cleaved into：
GeneID：29471
Gene names (primary )：Npy4r
Gene names (synonym )：Ppyr1
Gene names (ORF )：
Length：375
Mass：42,568
Sequence：MNTSHLMASLSPAFLQGKNGTNPLDSLYNLSDGCQDSADLLAFIITTYSVETVLGVLGNLCLIFVTTRQKEKSNVTNLLIANLAFSDFLMCLICQPLTVTYTIMDYWIFGEVLCKMLTFIQCMSVTVSILSLVLVALERHQLIINPTGWKPSISQAYLGIVVIWFISCFLSLPFLANSILNDLFHYNHSKVVEFLEDKVVCFVSWSSDHHRLIYTTFLLLFQYCVPLAFILVCYMRIYQRLQRQRRAFHTHTCSSRVGQMKRINGMLMAMVTAFAVLWLPLHVFNTLEDWYQEAIPACHGNLIFLMCHLFAMASTCVNPFIYGFLNINFKKDIKALVLTCRCRPPQGEPEPLPLSTVHTDLSKGSMRMGSKSNVM
Tissue specificity：Detected in colon and brain. 1
Induction：
Developmental stage：
Protein families：