SIT1_RAT   Q5M869


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5M869

Recommended name:Signaling threshold-regulating transmembrane adapter 1

EC number:

Alternative names:

Cleaved into:

GeneID:500449

Gene names  (primary ):Sit1

Gene names  (synonym ):Sit

Gene names  (ORF ):

Length:178

Mass:19,368

Sequence:MSRENNCTTADLAWGIPSITQAWGLWALFGVVTMLLLISLAALLSQWTRGRRRTQEEQGPPSGRSVEEVPLYGNLHYLQTGRLSEESRSEEQDPSSGGLARGAEEATCYTSLQLRPAQGRIPSSGTPIKYCEVVLDSEPKPQASGPEPELYASVCAQTRRARASFPDQAYANSQPAPS

Tissue specificity:Lymph node, spleen and thymus. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp