VR102_RAT Q5J3K5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5J3K5
Recommended name：Vomeronasal type-1 receptor 102
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Vom1r102
Gene names (synonym )：V1ra15, Vnr2 Imported
Gene names (ORF )：
Length：336
Mass：38,467
Sequence：MVGVQICQGMTSEILFFSLQPQFSNMMNKNSRLHIDSNIRNTFFTEIGIGVSANSLLLLFNIFKFIHGQRSRLTDLPIGLLSLINLLMLLIMACIATDIFISCRRWDDIICKSLLYLYRTFRGLSLSTTCLLSVLQAIILSPRSSCLAKYKHKPPHHIFCAMLFLSVLYMFISSHLLLSIIATPNLTTNDFIHVSQSCSILPMSYLMQSMFSTLLAIRNVFLISLIVLSTWYMVALLCRHRKQTRHLQDTSLSRKASPEQRATRSILMLRSLFVLMSIFDSIVSCSRTMYLNDPTSYSIQLLVVHIYATVSPFVFMITEKHIVNYLKSMYVRVLNV
Tissue specificity：Expressed in 1-4% of neurons of the vomeronasal organ. Only one pheromone receptor gene may be expressed in a particular neuron. Not expressed in the main olfactory epithelium. 1
Induction：
Developmental stage：
Protein families：