MIA40_RAT   Q5BJN5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5BJN5

Recommended name:Mitochondrial intermembrane space import and assembly protein 40

EC number:

Alternative names:

Cleaved into:

GeneID:312559

Gene names  (primary ):Chchd4

Gene names  (synonym ):Mia40

Gene names  (ORF ):

Length:139

Mass:15,467

Sequence:MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGDINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEDIKGSDCIDQFRAMQECMQKYPDLYPQDEEEEEEAKPVEPVEETADTKASAAKEQGASS

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp