AMTN_RAT Q3HS82
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3HS82
Recommended name：Amelotin
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Amtn
Gene names (synonym )：EO-017
Gene names (ORF )：
Length：212
Mass：22,080
Sequence：MKTVVLLLCLLGSAQSLPRQLSPALGAPATKPTPGQVTPLTQQQPNQVFPSISLIPLTQLLTLGSDLPLFNPATMPHGTQTLPFTLGPLNGQQQLQPQMLPIIVAQLGAQGALLSSEELPLASQIFTGLLIHPLFPGAIQPSGQTGAKPDVQNGALPTRQAGASPANQATTPGHTTPAVTDDDDYEMSTPAGLQRATHTTEGTTMDPPNRTK
Tissue specificity：Highest expression in the mandible. Found in the basal lamina of maturation stage ameloblasts of incisors and unerupted molars. Also found in the internal basal lamina of junctional epithelium in molars. 1
Induction：
Developmental stage：Expressed in ameloblasts as they undergo post-secretory transition. Expression decreases as ameloblasts progress through maturation. 1
Protein families：