BATF3_RAT P97876
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P97876
Recommended name：Basic leucine zipper transcriptional factor ATF-like 3
EC number：
Alternative names：Jun dimerization protein 1 (JDP-1)
Cleaved into：
GeneID：60462
Gene names (primary )：Batf3
Gene names (synonym )：Jdp1
Gene names (ORF )：
Length：133
Mass：15,129
Sequence：MSQGPPAGGVLQSSVAAPGNQPQSPKDDDRKVRRREKNRVAAQRSRKKQTQKSDKLHEEHESLEQENSVLRREIAKLKEELRHLTEALKEHEKMCPLLLCPMNFVQLRPDPVASWSAHDAPDHPSFIWLGTLV
Tissue specificity：Ubiquitously expressed. 1
Induction：
Developmental stage：
Protein families：