CRIP1_RAT   P63255


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P63255

Recommended name:Cysteine-rich protein 1

EC number:

Alternative names:Cysteine-rich intestinal protein (CRIP)

Cleaved into:

GeneID:691657

Gene names  (primary ):Crip1

Gene names  (synonym ):Crip

Gene names  (ORF ):

Length:77

Mass:8,550

Sequence:MPKCPKCDKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYSAMFGPKGFGRGGAESHTFK

Tissue specificity:The concentration in intestinal tissues undergoes an abrupt increase during the animal's transition from suckling to weaning.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp