OX1R_RAT   P56718


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P56718

Recommended name:Orexin/Hypocretin receptor type 1 1 Publication

EC number:

Alternative names:

Cleaved into:

GeneID:25593

Gene names  (primary ):Hcrtr1

Gene names  (synonym ):

Gene names  (ORF ):

Length:416

Mass:46,800

Sequence:MEPSATPGAQPGVPTSSGEPFHLPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFLIALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAVMVPQAAVMECSSVLPELANRTRLFSVCDERWADELYPKIYHSCFFFVTYLAPLGLMGMAYFQIFRKLWGPQIPGTTSALVRNWKRPSEQLEAQHQGLCTEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPSSSARHKSLSLQSRCSVSKVSEHVVLTTVTTVLS

Tissue specificity:Highly expressed in the brain in the prefrontal cortex, hippocampus, paraventricular thalamus, ventromedial hypothalamus, arcuate nucleus, dorsal raphe nucleus, and locus coeruleus. Not detected in the spleen, lung, liver, skeletal muscle, kidney and testis. Orexin receptor mRNA expression has also been reported in the adrenal gland, enteric nervous system, and pancreas. 1

Induction:

Developmental stage:By nutritional state, up-regulated by fasting. 1

Protein families:G-protein coupled receptor 1 family


   💬 WhatsApp