VATF_RAT   P50408


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P50408

Recommended name:V-type proton ATPase subunit F

EC number:

Alternative names:V-ATPase 14 kDa subunit Vacuolar proton pump subunit F

Cleaved into:

GeneID:116664

Gene names  (primary ):Atp6v1f

Gene names  (synonym ):Atp6s14, Vatf

Gene names  (ORF ):

Length:119

Mass:13,370

Sequence:MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQRSIPAVLEIPSKEHPYDAAKDSILRRAKGMFTAEDLR

Tissue specificity:Expressed in brain (at protein level). 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp