SCG3_RAT P47868
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P47868
Recommended name：Secretogranin-3
EC number：
Alternative names：
Cleaved into：
GeneID：116635
Gene names (primary )：Scg3
Gene names (synonym )：
Gene names (ORF )：
Length：471
Mass：53,183
Sequence：MGFLWTGSWILVLVLNSGPIQAFPKPEGSQDKSLHNRELSAERPLNEQIAEAEADKIKKTYPSESKPSESNFSSVDNLNLLKAITEKETVEKAKQSIRSSPFDNRLNVDDADSTKNRKLTDEYDSTKSGLDRKVQDDPDGLHQLDGTPLTAEDIVHKIATRIYEENDRGVFDKIVSKLLNLGLITESQAHTLEDEVAEALQKLISKEANNYEEAPEKPTSRTENQDGKIPEKVTPVAATQDGFTNRENDDTVSNTLTLSNGLERRTNPHRDDDFEELQYFPNFYALLTSIDSEKEAKEKETLITIMKTLIDFVKMMVKYGTISPEEGVSYLENLDETIALQTKNKLEKNTTDSKSKLFPAPPEKSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNLGGKTDEAKGKTEAYLEAIRKNIEWLKKHNKKGNKEDYDLSKMRDFINQQADAYVEKGILDKEEANAIKRIYSSL
Tissue specificity：Expression restricted to the brain and pituitary gland. Not detected in the adrenal gland. 2 s
Induction：
Developmental stage：
Protein families：