GBG7_RAT   P43425


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P43425

Recommended name:Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7

EC number:

Alternative names:

Cleaved into:

GeneID:58979

Gene names  (primary ):Gng7

Gene names  (synonym ):Gngt7

Gene names  (ORF ):

Length:68

Mass:7,524

Sequence:MSGTNNVAQARKLVEQLRIEAGIERIKVSKASSELMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL

Tissue specificity:Expressed in a variety of tissues.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp