TAGL_RAT   P31232


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P31232

Recommended name:Transgelin

EC number:

Alternative names:

Cleaved into:

GeneID:25123

Gene names  (primary ):Tagln

Gene names  (synonym ):Sm22

Gene names  (ORF ):

Length:201

Mass:22,603

Sequence:MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIVMQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPEGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVTKTDMFQTVDLFEGKDMAAVQRTVMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTDSQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS

Tissue specificity:Smooth muscle and mesenchymal cells but not in skeletal muscle or lymphocytes.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp