ARRS_RAT   P15887


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P15887

Recommended name:S-arrestin

EC number:

Alternative names:

Cleaved into:

GeneID:25539

Gene names  (primary ):Sag

Gene names  (synonym ):

Gene names  (ORF ):

Length:403

Mass:44,950

Sequence:MAACVKTNKSHVIFKKVSRDKSVTIYLGKRDYIDHVSQVEPVDGVVLVDPELVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAMSAPTQLQLSLLKKLGDNTYPFLLTFPDYLPCSVMLQPAPQDVGKSCGVDFEVKAFATDITDAEEDKIPKKSSVRLLIRKVQHAPPEMGPQPCAEASWQFFMSDKPLHLSVSLSKEIYFHGEPIPVTVTVTNNTEKVVKKIKVSVEQIANVVLYSSDYYVKPVASEETQEKVQPNSTLTKTLVLVPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVMGILVSYHIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESVQDENLVFEEFARQNLKDTGENTEGKKDEDAGQDE

Tissue specificity:Retina and pineal gland. 1

Induction:

Developmental stage:

Protein families:arrestin family


   💬 WhatsApp