COX5A_RAT P11240
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P11240
Recommended name：Cytochrome c oxidase subunit 5A, mitochondrial
EC number：
Alternative names：
Cleaved into：
GeneID：252934
Gene names (primary )：Cox5a
Gene names (synonym )：
Gene names (ORF )：
Length：146
Mass：16,130
Sequence：MLAAALRRCTAAAAARGLLHPVSAPSPAAAVCSIRCYSHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Tissue specificity：Expressed in the head of epididymal sperm but not in testicular sperm (at protein level). 1
Induction：
Developmental stage：
Protein families：