B3GT4_RAT O88178
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88178
Recommended name:Beta-1,3-galactosyltransferase 4
EC number:EC:2.4.1.62
Alternative names:Beta-1,3-GalTase 4; Beta3Gal-T4; Beta3GalT4; b3Gal-T4
Cleaved into:
GeneID:
Gene names (primary ):B3galt4
Gene names (synonym ):
Gene names (ORF ):
Length:371
Mass:41,254
Sequence:MPLSLFRRLLLAVLLLVIIWTLFGPSGLGEELLSLSLASLLPAPASPGPPLALPRLLIPNPQACGGSGPPPFLLILVCTAPEHLNQRNAIRGSWGAIREARGFRVQTLFLLGEPMGQQFADLASESAAQGDVLQASFQDSYRNLTLKTLTGLNWVNKYCPMARYILKTDDDVYVNVPELVSELIQRGGPSEQWQKGKEPQEETTAVHKEHKGQAVPLLYLGRVHWRVRPTRTPESRHHVSEELWPENWGPFPPYASGTGYVLSISAVQLILKVASRAPYLPLEDVFVGVSARRVGLAPTHCVKLAGATHYPLDRCCYGKFLLTSHKVDPWKMQEAWKLVRGLNGRRTEPFCSWLQGFLGTLRCRFIAWLNS
Tissue specificity:Highly expressed in thymus, spleen, kidney and testis and, to a lesser extent, in brain and liver. 1
Induction:
Developmental stage:In the embryonic brain, expression begins at day 12 and continues until birth. Expression is maintained at low levels in adult brain. 1
Protein families: