PEX12_RAT O88177
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88177
Recommended name:Peroxisome assembly protein 12 Curated
EC number:
Alternative names:
Cleaved into:
GeneID:116718
Gene names (primary ):Pex12
Gene names (synonym ):Paf3
Gene names (ORF ):
Length:359
Mass:40,681
Sequence:MAEHGAHITTASVADDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPAHYGFFWRWFDEIFTLLDFLLQQHYLSRTSASFSEHFYGLKRIVAGSSPQLQRPASAGLPKEHLWKSAMFLVLLPYLKVKLEKLASTLREEDEYSIHPPSSHWKRFYRVFLAAYPFVTMTWEGWFLTQQLRYILGKAEHHSPLLKLAGVRLGRLTAQDIQAMEHRLVEASAMQEPVRSIGKKIKSALKKAVGGVALSLSTGLSVGVFFLQFLDWWYSSENQETIKSLTALPTPPPPVHLDYNSDSPLLPKMKTVCPLCRKARVNDTVLATSGYVFCYRCVFNYVRSHQACPITGYPTEVQHLIKLYSPEN
Tissue specificity:
Induction:
Developmental stage:
Protein families: