CNMD_RAT O70367
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O70367
Recommended name：Leukocyte cell-derived chemotaxin 1 Curated
EC number：
Alternative names：Chondrosurfactant protein (CH-SP) Chondromodulin-1 Alternative names: Chondromodulin-I (ChM-I)
Cleaved into：
GeneID：81512
Gene names (primary )：Cnmd
Gene names (synonym )：Chmi Imported, Lect1 Imported
Gene names (ORF )：
Length：334
Mass：37,387
Sequence：MTENSDKVPITMVGPEDVEFCSPPAYATVTVKPSGSPTRLLKVGAVVLISGAVLLLFGAIGAFYFWKGNDNHIYNVHYTMSINGRLQDASMEIDAANNLETFKMGSGAEEAIEVNDFQNGITGIRFAGGEKCYIKAQVKARIPEVSTGTKQSISELEGKIMPVKYEENSLIWVAVDQPVKDNSFLSSKILEFCGDLPIFWLKPMYPKEIPRERREVVRSSAPSTTRRPHSEPRGNAGPGRLSNRTRPSVQDDEEPFNPDNPYHQQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPLGGYYPWPYNYQGCRSACRVVMPCSWWVARILGMV
Tissue specificity：Detected in cartilage, cardiac valves and valvular interstitial cells (at protein level). Expressed in eye. 1
Induction：
Developmental stage：Expression first detected in heart at 9.5 dpc and persisted in the adult. 1
Protein families：