GBB4_RAT O35353
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35353
Recommended name：Guanine nucleotide-binding protein subunit beta-4
EC number：
Alternative names：
Cleaved into：
GeneID：294962
Gene names (primary )：Gnb4
Gene names (synonym )：
Gene names (ORF )：
Length：340
Mass：37,363
Sequence：MSELEQLRQEAEQLRNQIQDARKACNDATLVQITSNMDSVGRIQMRTRRTLRGHLAKIYAMHWGYDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELPGHTGYLSCCRFLDDGQIITSSGDTTCALWDIETGQQTTTFTGHSGDVMSLSLSPDLKTFVSGACDASSKLWDIRDGMCRQSFTGHISDINAVSFFPSGYAFATGSDDATCRLFDLRADQELLLYSHDNIICGITSVAFSKSGRLLLAGYDDFNCSVWDALKGGRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLRIWN
Tissue specificity：Widely expressed in the brain. Highest levels found in the hippocampus and layers v and vi of the neocortex. 1
Induction：
Developmental stage：
Protein families：